Lineage for d1qzwe2 (1qzw E:295-432)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537444Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 537445Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 537446Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)
  6. 537447Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 537448Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)
  8. 537453Domain d1qzwe2: 1qzw E:295-432 [96706]
    Other proteins in same PDB: d1qzwa1, d1qzwa3, d1qzwc1, d1qzwc3, d1qzwe1, d1qzwe3, d1qzwg1, d1qzwg3

Details for d1qzwe2

PDB Entry: 1qzw (more details), 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzwe2 a.36.1.1 (E:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

SCOP Domain Coordinates for d1qzwe2:

Click to download the PDB-style file with coordinates for d1qzwe2.
(The format of our PDB-style files is described here.)

Timeline for d1qzwe2: