SCOP 1.69: Domain d1qzwe2: 1qzw E:295-432

Lineage for d1qzwe2 (1qzw E:295-432)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)

8. Domain d1qzwe2: 1qzw E:295-432 [96706]
   Other proteins in same PDB: d1qzwa1, d1qzwa3, d1qzwc1, d1qzwc3, d1qzwe1, d1qzwe3, d1qzwg1, d1qzwg3

Details for d1qzwe2

PDB Entry: 1qzw, 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication

SCOP Domain Sequences for d1qzwe2:

Sequence; same for both SEQRES and ATOM records:

>d1qzwe2 a.36.1.1 (E:295-432) Signal sequence binding protein Ffh {Archaeon Sulfolobus solfataricus}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

Timeline for d1qzwe2:

• d1qzwe2 first appeared in SCOP 1.67
  
• d1qzwe2 appears in SCOP 1.71
  
• d1qzwe2 appears in the current release, SCOPe 2.08