Lineage for d1qzwa2 (1qzw A:295-432)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913966Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
    4 helices; orthogonal array
  4. 913967Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family) (S)
  5. 913968Family a.36.1.1: Signal peptide-binding domain [47447] (3 proteins)
  6. 913969Protein Signal sequence binding protein Ffh [47448] (3 species)
  7. 913984Species Sulfolobus solfataricus [TaxId:2287] [101170] (2 PDB entries)
  8. 913987Domain d1qzwa2: 1qzw A:295-432 [96700]
    Other proteins in same PDB: d1qzwa1, d1qzwa3, d1qzwc1, d1qzwc3, d1qzwe1, d1qzwe3, d1qzwg1, d1qzwg3
    protein/RNA complex

Details for d1qzwa2

PDB Entry: 1qzw (more details), 4.1 Å

PDB Description: Crystal structure of the complete core of archaeal SRP and implications for inter-domain communication
PDB Compounds: (A:) signal recognition 54 kda protein

SCOPe Domain Sequences for d1qzwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qzwa2 a.36.1.1 (A:295-432) Signal sequence binding protein Ffh {Sulfolobus solfataricus [TaxId: 2287]}
gdiesilekvkgleeydkiqkkmedvmegkgkltlrdvyaqiialrkmgplskvlqhipg
lgimlptpsedqlkigeekirrwlaalnsmtykelenpniidksrmrriaegsgleveev
rellewynnmnrllkmvk

SCOPe Domain Coordinates for d1qzwa2:

Click to download the PDB-style file with coordinates for d1qzwa2.
(The format of our PDB-style files is described here.)

Timeline for d1qzwa2: