Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.33: SecB-like [54610] (1 superfamily) beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432 |
Superfamily d.33.1: SecB-like [54611] (3 families) |
Family d.33.1.1: Bacterial protein-export protein SecB [54612] (1 protein) automatically mapped to Pfam PF02556 |
Protein Bacterial protein-export protein SecB [54613] (2 species) |
Species Escherichia coli [TaxId:562] [102884] (1 PDB entry) |
Domain d1qync_: 1qyn C: [96599] |
PDB Entry: 1qyn (more details), 2.35 Å
SCOPe Domain Sequences for d1qync_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qync_ d.33.1.1 (C:) Bacterial protein-export protein SecB {Escherichia coli [TaxId: 562]} mtfqiqriytkdisfeapnaphvfqkdwqpevkldldtassqladdvyevvlrvtvtasl geetaflcevqqggifsiagiegtqmahclgaycpnilfpyarecitsmvsrgtfpqlnl apvnfdalfmny
Timeline for d1qync_: