Lineage for d1qyda_ (1qyd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451025Protein Pinoresinol-lariciresinol reductase [102142] (1 species)
  7. 2451026Species Giant arborvitae (Thuja plicata) [TaxId:3316] [102143] (1 PDB entry)
  8. 2451027Domain d1qyda_: 1qyd A: [96583]

Details for d1qyda_

PDB Entry: 1qyd (more details), 2.5 Å

PDB Description: Crystal structures of pinoresinol-lariciresinol and phenylcoumaran benzylic ether reductases, and their relationship to isoflavone reductases
PDB Compounds: (A:) pinoresinol-lariciresinol reductase

SCOPe Domain Sequences for d1qyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]}
dkksrvlivggtgyigkrivnasislghptyvlfrpevvsnidkvqmllyfkqlgaklie
aslddhqrlvdalkqvdvvisalaggvlshhileqlklveaikeagnikrflpsefgmdp
dimehalqpgsitfidkrkvrraieaasipytyvssnmfagyfagslaqldghmmpprdk
vliygdgnvkgiwvdeddvgtytiksiddpqtlnktmyirppmnilsqkeviqiwerlse
qnldkiyissqdfladmkdksyeekivrchlyqiffrgdlynfeigpnaieatklypevk
yvtmdsyleryv

SCOPe Domain Coordinates for d1qyda_:

Click to download the PDB-style file with coordinates for d1qyda_.
(The format of our PDB-style files is described here.)

Timeline for d1qyda_: