SCOP 1.73: Domain d1qy7b_: 1qy7 B:

Lineage for d1qy7b_ (1qy7 B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (3 proteins)

6. Protein PII (product of glnB) [54915] (5 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (1 PDB entry)

8. Domain d1qy7b_: 1qy7 B: [96576]

Details for d1qy7b_

PDB Entry: 1qy7, 2 Å

PDB Description: the structure of the pii protein from the cyanobacteria synechococcus sp. pcc 7942

PDB Compounds: (B:) nitrogen regulatory protein p-II

SCOP Domain Sequences for d1qy7b_:

Sequence; same for both SEQRES and ATOM records:

>d1qy7b_ d.58.5.1 (B:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

Timeline for d1qy7b_:

• d1qy7b_ first appeared in SCOP 1.67
  
• d1qy7b_ appears in SCOP 1.71
  
• d1qy7b_ appears in SCOP 1.75
  
• d1qy7b_ appears in the current release, SCOPe 2.08