Lineage for d1qy7a_ (1qy7 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723963Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 723964Family d.58.5.1: Prokaryotic signal transducing protein [54914] (3 proteins)
  6. 723970Protein PII (product of glnB) [54915] (5 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 723971Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (1 PDB entry)
  8. 723972Domain d1qy7a_: 1qy7 A: [96575]

Details for d1qy7a_

PDB Entry: 1qy7 (more details), 2 Å

PDB Description: the structure of the pii protein from the cyanobacteria synechococcus sp. pcc 7942
PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOP Domain Sequences for d1qy7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qy7a_ d.58.5.1 (A:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai

SCOP Domain Coordinates for d1qy7a_:

Click to download the PDB-style file with coordinates for d1qy7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qy7a_: