Lineage for d1qvza_ (1qvz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858933Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2859041Protein Hypothetical protein Ydr533Cp [102253] (1 species)
    contains a buried Cys-His-Glu triad within one subunit
  7. 2859042Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102254] (4 PDB entries)
  8. 2859043Domain d1qvza_: 1qvz A: [96453]
    structural genomics

Details for d1qvza_

PDB Entry: 1qvz (more details), 1.85 Å

PDB Description: crystal structure of the s. cerevisiae ydr533c protein
PDB Compounds: (A:) YDR533c protein

SCOPe Domain Sequences for d1qvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvza_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apkkvllaltsyndvfysdgmktgvfvvealhpfntfrkegfevdfvsetgkfgwdehsl
akdflngqdetdfknkdsdfnktlakiktpkevnaddyqifmasaghgtlfdypkakdlq
diaseiyanggvvaavchgpamfdgltdkktgrpliegksitgftdvgetimgvdsilka
knlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsidalkn

SCOPe Domain Coordinates for d1qvza_:

Click to download the PDB-style file with coordinates for d1qvza_.
(The format of our PDB-style files is described here.)

Timeline for d1qvza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qvzb_