Lineage for d1qvwa_ (1qvw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589289Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 1589370Protein Hypothetical protein Ydr533Cp [102253] (1 species)
    contains a buried Cys-His-Glu triad within one subunit
  7. 1589371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102254] (4 PDB entries)
  8. 1589374Domain d1qvwa_: 1qvw A: [96446]
    structural genomics
    complexed with gol

Details for d1qvwa_

PDB Entry: 1qvw (more details), 1.9 Å

PDB Description: crystal structure of the s. cerevisiae ydr533c protein
PDB Compounds: (A:) YDR533c protein

SCOPe Domain Sequences for d1qvwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apkkvllaltsyndvfysdgmktgvfvvealhpfntfrkegfevdfvsetgkfgwdehsl
akdflngqdetdfknkdsdfnktlakiktpkevnaddyqifmasaghgtlfdypkakdlq
diaseiyanggvvaavchgpamfdgltdkktgrpliegksitgftdvgetimgvdsilka
knlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsidalkn

SCOPe Domain Coordinates for d1qvwa_:

Click to download the PDB-style file with coordinates for d1qvwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qvwa_: