Lineage for d1qvfk_ (1qvf K:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480304Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 480305Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 480306Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 480307Protein Ribosomal protein L15 (L15p) [52082] (1 species)
  7. 480308Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (19 PDB entries)
  8. 480317Domain d1qvfk_: 1qvf K: [96373]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfi_, d1qvfj_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_

Details for d1qvfk_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfk_:

Sequence, based on SEQRES records: (download)

>d1qvfk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d1qvfk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOP Domain Coordinates for d1qvfk_:

Click to download the PDB-style file with coordinates for d1qvfk_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfk_: