Lineage for d1qvfi_ (1qvf I:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481017Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 481018Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 481019Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 481020Protein Ribosomal protein L13 [52163] (2 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 481021Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (19 PDB entries)
  8. 481030Domain d1qvfi_: 1qvf I: [96371]
    Other proteins in same PDB: d1qvf1_, d1qvf2_, d1qvfa1, d1qvfa2, d1qvfb_, d1qvfc_, d1qvfd_, d1qvfe1, d1qvfe2, d1qvff_, d1qvfg_, d1qvfh_, d1qvfj_, d1qvfk_, d1qvfl_, d1qvfm_, d1qvfn_, d1qvfo_, d1qvfp_, d1qvfq_, d1qvfr_, d1qvfs_, d1qvft_, d1qvfu_, d1qvfv_, d1qvfw_, d1qvfx_, d1qvfy_, d1qvfz_

Details for d1qvfi_

PDB Entry: 1qvf (more details), 3.1 Å

PDB Description: structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui

SCOP Domain Sequences for d1qvfi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvfi_ c.21.1.1 (I:) Ribosomal protein L13 {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1qvfi_:

Click to download the PDB-style file with coordinates for d1qvfi_.
(The format of our PDB-style files is described here.)

Timeline for d1qvfi_: