Lineage for d1q9ya2 (1q9y A:376-902)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016563Protein Family B DNA polymerase [56680] (7 species)
  7. 3016564Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 3016642Domain d1q9ya2: 1q9y A:376-902 [96337]
    Other proteins in same PDB: d1q9ya1, d1q9ya3
    protein/DNA complex; complexed with ca, dcp

Details for d1q9ya2

PDB Entry: 1q9y (more details), 2.8 Å

PDB Description: crystal structure of enterobacteria phage rb69 gp43 dna polymerase complexed with 8-oxoguanosine containing dna
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d1q9ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ya2 e.8.1.1 (A:376-902) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
lkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiag
tfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaa
qrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevag
mtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgte
geafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremce
ymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimglet
qksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakyd
vggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgt
eitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfd

SCOPe Domain Coordinates for d1q9ya2:

Click to download the PDB-style file with coordinates for d1q9ya2.
(The format of our PDB-style files is described here.)

Timeline for d1q9ya2: