Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d1q9qa2: 1q9q A:108-213 [96302] Other proteins in same PDB: d1q9qa1, d1q9qb1, d1q9qb2 part of Fab s25-2 |
PDB Entry: 1q9q (more details), 1.49 Å
SCOP Domain Sequences for d1q9qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9qa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1q9qa2: