Lineage for d1q9ma_ (1q9m A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285679Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1285680Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1285765Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1285825Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 1285826Species Human (Homo sapiens) [TaxId:9606] [89152] (32 PDB entries)
    Uniprot Q08499 388-713
  8. 1285886Domain d1q9ma_: 1q9m A: [96288]
    complexed with rol, zn

Details for d1q9ma_

PDB Entry: 1q9m (more details), 2.3 Å

PDB Description: Three dimensional structures of PDE4D in complex with roliprams and implication on inhibitor selectivity
PDB Compounds: (A:) cAMP-specific phosphodiesterase PDE4D2

SCOPe Domain Sequences for d1q9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q9ma_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d1q9ma_:

Click to download the PDB-style file with coordinates for d1q9ma_.
(The format of our PDB-style files is described here.)

Timeline for d1q9ma_: