SCOPe 2.08: Domain d1q82s_: 1q82 S:

Lineage for d1q82s_ (1q82 S:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
   Uniprot P10970

8. Domain d1q82s_: 1q82 S: [96146]
   Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82d_, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
   protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82s_

PDB Entry: 1q82, 2.98 Å

PDB Description: crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit

PDB Compounds: (S:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d1q82s_:

Sequence; same for both SEQRES and ATOM records:

>d1q82s_ d.55.1.1 (S:) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1q82s_:

• d1q82s_ first appeared in SCOP 1.67
  
• d1q82s_ appears in SCOPe 2.07