SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q82d_ (1q82 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054227Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2054401Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2054402Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2054443Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 2054477Domain d1q82d_: 1q82 D: [96130]
    Other proteins in same PDB: d1q821_, d1q822_, d1q823_, d1q824_, d1q82c1, d1q82c2, d1q82e_, d1q82f_, d1q82g1, d1q82g2, d1q82h_, d1q82i_, d1q82j_, d1q82k_, d1q82l_, d1q82m_, d1q82n_, d1q82o_, d1q82p_, d1q82q_, d1q82r_, d1q82s_, d1q82t_, d1q82u_, d1q82v_, d1q82w_, d1q82x_, d1q82y_, d1q82z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q82d_

PDB Entry: 1q82 (more details), 2.98 Å

PDB Description: Crystal Structure of CC-Puromycin bound to the A-site of the 50S ribosomal subunit
PDB Compounds: (D:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1q82d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q82d_ b.43.3.2 (D:) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1q82d_:

Click to download the PDB-style file with coordinates for d1q82d_.
(The format of our PDB-style files is described here.)

Timeline for d1q82d_: