Lineage for d1q81u_ (1q81 U:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393545Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2393546Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2393589Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 2393629Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
    Uniprot P10972
  8. 2393655Domain d1q81u_: 1q81 U: [96118]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81u_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (U:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d1q81u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81u_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1q81u_:

Click to download the PDB-style file with coordinates for d1q81u_.
(The format of our PDB-style files is described here.)

Timeline for d1q81u_: