Lineage for d1q81l_ (1q81 L:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123581Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 1123582Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 1123583Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 1123584Protein Ribosomal protein L14 [50195] (5 species)
  7. 1123624Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 1123657Domain d1q81l_: 1q81 L: [96109]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    protein/RNA complex; complexed with cd, cl, k, mg, na, ppu

Details for d1q81l_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (L:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1q81l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81l_ b.39.1.1 (L:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1q81l_:

Click to download the PDB-style file with coordinates for d1q81l_.
(The format of our PDB-style files is described here.)

Timeline for d1q81l_: