Lineage for d1q81h_ (1q81 H:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865876Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 865893Protein Ribosomal protein L7ae [55319] (7 species)
  7. 865899Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 865948Domain d1q81h_: 1q81 H: [96105]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q814_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q81h_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (H:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1q81h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q81h_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1q81h_:

Click to download the PDB-style file with coordinates for d1q81h_.
(The format of our PDB-style files is described here.)

Timeline for d1q81h_: