Lineage for d1q814_ (1q81 4:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893376Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 893481Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 893482Protein Ribosomal protein L44e [57837] (1 species)
  7. 893483Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 893516Domain d1q814_: 1q81 4: [96097]
    Other proteins in same PDB: d1q811_, d1q812_, d1q813_, d1q81c1, d1q81c2, d1q81d_, d1q81e_, d1q81f_, d1q81g1, d1q81g2, d1q81h_, d1q81i_, d1q81j_, d1q81k_, d1q81l_, d1q81m_, d1q81n_, d1q81o_, d1q81p_, d1q81q_, d1q81r_, d1q81s_, d1q81t_, d1q81u_, d1q81v_, d1q81w_, d1q81x_, d1q81y_, d1q81z_
    complexed with cd, cl, k, mg, na, ppu

Details for d1q814_

PDB Entry: 1q81 (more details), 2.95 Å

PDB Description: crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
PDB Compounds: (4:) 50S ribosomal protein L44E

SCOP Domain Sequences for d1q814_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q814_ g.41.8.3 (4:) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1q814_:

Click to download the PDB-style file with coordinates for d1q814_.
(The format of our PDB-style files is described here.)

Timeline for d1q814_: