Lineage for d1q7ea1 (1q7e A:3-418)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493182Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2493183Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2493184Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
    forms interlocked homodimer of two ring-like subunits
  6. 2493241Protein Hypothetical protein YfdW [102709] (1 species)
  7. 2493242Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)
  8. 2493243Domain d1q7ea1: 1q7e A:3-418 [96035]
    Other proteins in same PDB: d1q7ea2
    structural genomics
    complexed with met, mpd

Details for d1q7ea1

PDB Entry: 1q7e (more details), 1.6 Å

PDB Description: Crystal Structure of YfdW protein from E. coli
PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1q7ea1:

Sequence, based on SEQRES records: (download)

>d1q7ea1 c.123.1.1 (A:3-418) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
lstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
tmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprli
fgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligl
laallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavp
rggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaha
rqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveve
qplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

Sequence, based on observed residues (ATOM records): (download)

>d1q7ea1 c.123.1.1 (A:3-418) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
lstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
tmlnsnkrsielntktaegkevmeklireadilvenfhpftwehiqeinprlifgsikgf
decspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligllaallhr
ektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavprggnagg
ggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaharqphifd
ifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveqplrgky
ltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

SCOPe Domain Coordinates for d1q7ea1:

Click to download the PDB-style file with coordinates for d1q7ea1.
(The format of our PDB-style files is described here.)

Timeline for d1q7ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7ea2