PDB entry 1q7e

View 1q7e on RCSB PDB site
Description: Crystal Structure of YfdW protein from E. coli
Class: transferase
Keywords: structural genomics, intertwined dimer, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2003-08-18, released 2003-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yfdW
    Species: Escherichia coli [TaxId:562]
    Gene: YFDW
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69902 (Start-417)
      • insertion (2)
      • modified residue (26)
      • modified residue (63)
      • modified residue (84)
      • modified residue (175)
      • modified residue (199)
      • modified residue (201)
      • modified residue (342)
      • modified residue (375)
      • modified residue (411)
      • expression tag (418)
    Domains in SCOPe 2.08: d1q7ea1, d1q7ea2
  • Heterogens: MET, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q7eA (A:)
    mslstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidal
    yftmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinpr
    lifgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlli
    gllaallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgda
    vprggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaysta
    harqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvve
    veqplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhaieg
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q7eA (A:)
    lstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
    tmlnsnkrsielntktaegkevmeklireadilvenfhpftwehiqeinprlifgsikgf
    decspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligllaallhr
    ektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavprggnagg
    ggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaharqphifd
    ifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveqplrgky
    ltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhaie