Lineage for d1q5za_ (1q5z A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014591Fold a.196: Invasion protein A (SipA) , C-terminal actin binding domain [101311] (1 superfamily)
    6 helices: orthogonal array
  4. 2014592Superfamily a.196.1: Invasion protein A (SipA) , C-terminal actin binding domain [101312] (1 family) (S)
    automatically mapped to Pfam PF09052
  5. 2014593Family a.196.1.1: Invasion protein A (SipA) , C-terminal actin binding domain [101313] (1 protein)
  6. 2014594Protein Invasion protein A (SipA) , C-terminal actin binding domain [101314] (1 species)
  7. 2014595Species Salmonella typhimurium [TaxId:90371] [101315] (1 PDB entry)
  8. 2014596Domain d1q5za_: 1q5z A: [95954]

Details for d1q5za_

PDB Entry: 1q5z (more details), 1.8 Å

PDB Description: Crystal Structure of the C-terminal Actin Binding Domain of Salmonella Invasion Protein A (SipA)
PDB Compounds: (A:) SipA

SCOPe Domain Sequences for d1q5za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5za_ a.196.1.1 (A:) Invasion protein A (SipA) , C-terminal actin binding domain {Salmonella typhimurium [TaxId: 90371]}
pfsglkfkqnsflstvpsvtnmhsmhfdaretflgvirkalepdtstpfpvrrafdglra
eilpndtiksaalkaqcsdidkhpelkakmetlkevithhpqkeklaeialqfareaglt
rlkgetdyvlsnvldgligdgswra

SCOPe Domain Coordinates for d1q5za_:

Click to download the PDB-style file with coordinates for d1q5za_.
(The format of our PDB-style files is described here.)

Timeline for d1q5za_: