Lineage for d1q53a_ (1q53 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723797Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
  6. 723827Protein Hypothetical protein AT3G17210.1 [89928] (1 species)
  7. 723828Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (3 PDB entries)
  8. 723831Domain d1q53a_: 1q53 A: [95858]

Details for d1q53a_

PDB Entry: 1q53 (more details)

PDB Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081
PDB Compounds: (A:) expressed protein: At3g17210

SCOP Domain Sequences for d1q53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q53a_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

SCOP Domain Coordinates for d1q53a_:

Click to download the PDB-style file with coordinates for d1q53a_.
(The format of our PDB-style files is described here.)

Timeline for d1q53a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q53b_