Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins) |
Protein Hypothetical protein AT3G17210.1 [89928] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (3 PDB entries) |
Domain d1q53a_: 1q53 A: [95858] |
PDB Entry: 1q53 (more details)
SCOP Domain Sequences for d1q53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q53a_ d.58.4.4 (A:) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
Timeline for d1q53a_: