SCOP 1.69: Domain d1q4qa_: 1q4q A:

Lineage for d1q4qa_ (1q4q A:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (5 proteins)

6. Protein BIR domains of DIAP1 [69974] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69975] (6 PDB entries)

8. Domain d1q4qa_: 1q4q A: [95813]

Details for d1q4qa_

PDB Entry: 1q4q, 2.1 Å

PDB Description: crystal structure of a diap1-dronc complex

SCOP Domain Sequences for d1q4qa_:

Sequence; same for both SEQRES and ATOM records:

>d1q4qa_ g.52.1.1 (A:) BIR domains of DIAP1 {Fruit fly (Drosophila melanogaster)}
yfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdwnd
ndepweqhalwlsqcrfvklmkgqlyidtvaakp

Timeline for d1q4qa_:

• d1q4qa_ first appeared in SCOP 1.67
  
• d1q4qa_ appears in SCOP 1.71
  
• d1q4qa_ appears in the current release, SCOPe 2.08