Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily) 3-helical bundle packed against 3-stranded mixed beta-sheet |
Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) |
Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein) |
Protein Thermosome, I domain [54854] (3 species) |
Species Thermococcus sp. ks-1, alpha chain [TaxId:79679] [102951] (4 PDB entries) |
Domain d1q3sd3: 1q3s D:146-216,D:370-405 [95739] Other proteins in same PDB: d1q3sa1, d1q3sa2, d1q3sb1, d1q3sb2, d1q3sc1, d1q3sc2, d1q3sd1, d1q3sd2, d1q3se1, d1q3se2, d1q3sf1, d1q3sf2, d1q3sg1, d1q3sg2, d1q3sh1, d1q3sh2 complexed with adp, mg |
PDB Entry: 1q3s (more details), 3 Å
SCOPe Domain Sequences for d1q3sd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3sd3 d.56.1.2 (D:146-216,D:370-405) Thermosome, I domain {Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} vdpddeetllkiaatsitgknaeshkellaklaveavkqvaekkdgkyvvdldnikfekk agegveeselvXkavtilirggtehvideveraledavkvvkdvmedg
Timeline for d1q3sd3: