Lineage for d1q3ge_ (1q3g E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656170Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1656184Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 1656194Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 1656235Protein UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) [55210] (3 species)
  7. 1656236Species Enterobacter cloacae [TaxId:550] [55212] (12 PDB entries)
    Uniprot P33038
  8. 1656267Domain d1q3ge_: 1q3g E: [95676]
    complexed with edo, uda

Details for d1q3ge_

PDB Entry: 1q3g (more details), 2.65 Å

PDB Description: mura (asp305ala) liganded with tetrahedral reaction intermediate
PDB Compounds: (E:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d1q3ge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3ge_ d.68.2.2 (E:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]}
mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
afptamqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge

SCOPe Domain Coordinates for d1q3ge_:

Click to download the PDB-style file with coordinates for d1q3ge_.
(The format of our PDB-style files is described here.)

Timeline for d1q3ge_: