Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Stromelysin-2 (MMP-10) [103128] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103129] (1 PDB entry) |
Domain d1q3ab_: 1q3a B: [95665] complexed with ca, ngh, zn |
PDB Entry: 1q3a (more details), 2.1 Å
SCOPe Domain Sequences for d1q3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3ab_ d.92.1.11 (B:) Stromelysin-2 (MMP-10) {Human (Homo sapiens) [TaxId: 9606]} gmpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfa vkehgdnysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghsl glfhsantealmyplynsftelaqfrlsqddvngiqslyg
Timeline for d1q3ab_: