Lineage for d1q1pa1 (1q1p A:2-101)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936638Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 936639Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 936647Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 936660Species Mouse (Mus musculus) [TaxId:10090] [49318] (5 PDB entries)
  8. 936670Domain d1q1pa1: 1q1p A:2-101 [95597]
    two-domain fragment
    complexed with ca

Details for d1q1pa1

PDB Entry: 1q1p (more details), 3.2 Å

PDB Description: E-Cadherin activation
PDB Compounds: (A:) epithelial-cadherin

SCOPe Domain Sequences for d1q1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1pa1 b.1.6.1 (A:2-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d1q1pa1:

Click to download the PDB-style file with coordinates for d1q1pa1.
(The format of our PDB-style files is described here.)

Timeline for d1q1pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1pa2