Lineage for d1q1ma_ (1q1m A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833132Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 833133Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 833183Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 833215Protein Tyrosine phosphatase [52806] (7 species)
  7. 833216Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (91 PDB entries)
    Uniprot P18031 2-300
    Uniprot P18031 1-298
    Uniprot P18031 2-299
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 833299Domain d1q1ma_: 1q1m A: [95595]
    complexed with 234

Details for d1q1ma_

PDB Entry: 1q1m (more details), 2.6 Å

PDB Description: a highly efficient approach to a selective and cell active ptp1b inhibitors
PDB Compounds: (A:) protein-tyrosine phosphatase, non-receptor type 1

SCOP Domain Sequences for d1q1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle

SCOP Domain Coordinates for d1q1ma_:

Click to download the PDB-style file with coordinates for d1q1ma_.
(The format of our PDB-style files is described here.)

Timeline for d1q1ma_: