Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
Species Escherichia coli [TaxId:562] [101772] (15 PDB entries) |
Domain d1q1bc1: 1q1b C:236-370 [95566] Other proteins in same PDB: d1q1ba2, d1q1bb2, d1q1bc2, d1q1bd2 |
PDB Entry: 1q1b (more details), 2.8 Å
SCOPe Domain Sequences for d1q1bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1bc1 b.40.6.3 (C:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]} spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf redgtacrrlhkepg
Timeline for d1q1bc1: