Lineage for d1q15b2 (1q15 B:2-205)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735800Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 735819Protein beta-Lactam synthetase [69831] (2 species)
    Asparagine synthetase B homologue
  7. 735820Species Pectobacterium carotovorum [TaxId:554] [103312] (2 PDB entries)
    carbapenam synthetase CarA
  8. 735822Domain d1q15b2: 1q15 B:2-205 [95541]
    Other proteins in same PDB: d1q15a1, d1q15b1, d1q15c1, d1q15d1

Details for d1q15b2

PDB Entry: 1q15 (more details), 2.3 Å

PDB Description: Carbapenam Synthetase
PDB Compounds: (B:) CarA

SCOP Domain Sequences for d1q15b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q15b2 d.153.1.1 (B:2-205) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
pgavhvlthdsegysfvesrtltt

SCOP Domain Coordinates for d1q15b2:

Click to download the PDB-style file with coordinates for d1q15b2.
(The format of our PDB-style files is described here.)

Timeline for d1q15b2: