![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.28: Aclacinomycin methylesterase RdmC [102620] (1 protein) automatically mapped to Pfam PF12697 |
![]() | Protein Aclacinomycin methylesterase RdmC [102621] (1 species) |
![]() | Species Streptomyces purpurascens [TaxId:1924] [102622] (2 PDB entries) |
![]() | Domain d1q0ra_: 1q0r A: [95508] complexed with 1pe, akt, so4 |
PDB Entry: 1q0r (more details), 1.45 Å
SCOPe Domain Sequences for d1q0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} serivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhrd tgrsttrdfaahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrlss ltmllgggldidfdaniervmrgeptldglpgpqqpfldalalmnqpaegraaevakrvs kwrilsgtgvpfddaeyarweeraidhaggvlaepyahysltlpppsraaelrevtvptl viqaehdpiapaphgkhlagliptarlaeipgmghalpssvhgplaevilahtrsaa
Timeline for d1q0ra_: