PDB entry 1q0r

View 1q0r on RCSB PDB site
Description: Crystal structure of aclacinomycin methylesterase (RdmC) with bound product analogue, 10-decarboxymethylaclacinomycin T (DcmaT)
Class: hydrolase
Keywords: Anthracycline, methylesterase, hydrolase, polyketide, Streptomyces, tailoring enzyme, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2003-07-17, released 2003-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aclacinomycin methylesterase
    Species: Streptomyces purpurascens [TaxId:1924]
    Gene: rdmc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0ra_
  • Heterogens: AKT, SO4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q0rA (A:)
    mserivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhr
    dtgrsttrdfaahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrls
    sltmllgggldidfdaniervmrgeptldglpgpqqpfldalalmnqpaegraaevakrv
    skwrilsgtgvpfddaeyarweeraidhaggvlaepyahysltlpppsraaelrevtvpt
    lviqaehdpiapaphgkhlagliptarlaeipgmghalpssvhgplaevilahtrsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q0rA (A:)
    serivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhrd
    tgrsttrdfaahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrlss
    ltmllgggldidfdaniervmrgeptldglpgpqqpfldalalmnqpaegraaevakrvs
    kwrilsgtgvpfddaeyarweeraidhaggvlaepyahysltlpppsraaelrevtvptl
    viqaehdpiapaphgkhlagliptarlaeipgmghalpssvhgplaevilahtrsaa