Class a: All alpha proteins [46456] (218 folds) |
Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.2: Docking domain B of the erythromycin polyketide synthase (DEBS) [101173] (1 family) |
Family a.38.2.1: Docking domain B of the erythromycin polyketide synthase (DEBS) [101174] (1 protein) |
Protein Erythronolide synthase [101175] (1 species) |
Species Saccharopolyspora erythraea [TaxId:1836] [101176] (1 PDB entry) |
Domain d1pzra_: 1pzr A: [95468] |
PDB Entry: 1pzr (more details)
SCOP Domain Sequences for d1pzra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzra_ a.38.2.1 (A:) Erythronolide synthase {Saccharopolyspora erythraea} asddelfsmldqrfgggedllmsgdngmteeklrrylkrtvteldsvtarlrevehrage
Timeline for d1pzra_: