SCOPe 2.08: Domain d1pzra_: 1pzr A:

Lineage for d1pzra_ (1pzr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.38: HLH-like [47458] (2 superfamilies)
   4-helices; bundle, closed, left-handed twist; 2 crossover connections

4. Superfamily a.38.2: Docking domain B of the erythromycin polyketide synthase (DEBS) [101173] (1 family)

5. Family a.38.2.1: Docking domain B of the erythromycin polyketide synthase (DEBS) [101174] (1 protein)

6. Protein Erythronolide synthase [101175] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [101176] (1 PDB entry)

8. Domain d1pzra_: 1pzr A: [95468]
   fused interacting segments

Details for d1pzra_

PDB Entry: 1pzr

PDB Description: structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs2 and debs3: the b domain

PDB Compounds: (A:) erythronolide synthase

SCOPe Domain Sequences for d1pzra_:

Sequence; same for both SEQRES and ATOM records:

>d1pzra_ a.38.2.1 (A:) Erythronolide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
asddelfsmldqrfgggedllmsgdngmteeklrrylkrtvteldsvtarlrevehrage

Timeline for d1pzra_:

• d1pzra_ first appeared in SCOP 1.67
  
• d1pzra_ appears in SCOPe 2.07