Lineage for d1pzoa_ (1pzo A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232943Protein beta-Lactamase, class A [56606] (15 species)
  7. 1232966Species Escherichia coli, TEM-1 [TaxId:562] [56607] (35 PDB entries)
  8. 1232992Domain d1pzoa_: 1pzo A: [95464]
    complexed with cbt

Details for d1pzoa_

PDB Entry: 1pzo (more details), 1.9 Å

PDB Description: tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1pzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzoa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1pzoa_:

Click to download the PDB-style file with coordinates for d1pzoa_.
(The format of our PDB-style files is described here.)

Timeline for d1pzoa_: