Lineage for d1pzjg_ (1pzj G:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1123909Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1123910Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1123911Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1123940Domain d1pzjg_: 1pzj G: [95449]
    complexed with 15b, j15

Details for d1pzjg_

PDB Entry: 1pzj (more details), 1.46 Å

PDB Description: cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
PDB Compounds: (G:) cholera toxin b subunit

SCOPe Domain Sequences for d1pzjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzjg_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1pzjg_:

Click to download the PDB-style file with coordinates for d1pzjg_.
(The format of our PDB-style files is described here.)

Timeline for d1pzjg_: