| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (17 species) |
| Species Toxoplasma gondii [TaxId:5811] [102166] (5 PDB entries) |
| Domain d1pzfb1: 1pzf B:14-163 [95419] Other proteins in same PDB: d1pzfa2, d1pzfb2, d1pzfc2, d1pzfd2 complexed with a3d, oxl |
PDB Entry: 1pzf (more details), 2.2 Å
SCOPe Domain Sequences for d1pzfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzfb1 c.2.1.5 (B:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm
Timeline for d1pzfb1: