SCOPe 2.01: Domain d1pzfa1: 1pzf A:14-163

Lineage for d1pzfa1 (1pzf A:14-163)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Lactate dehydrogenase [51859] (14 species)

7. Species Toxoplasma gondii [TaxId:5811] [102166] (4 PDB entries)

8. Domain d1pzfa1: 1pzf A:14-163 [95417]
   Other proteins in same PDB: d1pzfa2, d1pzfb2, d1pzfc2, d1pzfd2
   complexed with a3d, oxl

Details for d1pzfa1

PDB Entry: 1pzf, 2.2 Å

PDB Description: T.gondii LDH1 ternary complex with APAD+ and oxalate

PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d1pzfa1:

Sequence; same for both SEQRES and ATOM records:

>d1pzfa1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]}
palvqrrkkvamigsgmiggtmgylcalreladvvlydvvkgmpegkaldlshvtsvvdt
nvsvraeysyeaaltgadcvivtagltkvpgkpdsewsrndllpfnskiireigqnikky
cpktfiivvtnpldcmvkvmceasgvptnmicgm

Timeline for d1pzfa1:

• d1pzfa1 first appeared in SCOP 1.67
  
• d1pzfa1 appears in SCOP 1.75
  
• d1pzfa1 appears in SCOPe 2.02
  
• d1pzfa1 appears in the current release, SCOPe 2.08