![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.3: Coatomer appendage domain [101536] (1 protein) |
![]() | Protein Coatomer gamma subunit C-terminal domain, first subdomain [101537] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [101539] (1 PDB entry) |
![]() | Domain d1pzda1: 1pzd A:604-762 [95413] Other proteins in same PDB: d1pzda2 complexed with so4 |
PDB Entry: 1pzd (more details), 2.31 Å
SCOPe Domain Sequences for d1pzda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzda1 b.1.10.3 (A:604-762) Coatomer gamma subunit C-terminal domain, first subdomain {Cow (Bos taurus) [TaxId: 9913]} kvaatrqeifqeqlaavpefqglgplfksspepvalteseteyvirctkhtftdhmvfqf dctntlndqtlenvtvqmepseayevlcyvparslpynqpgtcytlvalpkedptavact fscvmkftvkdcdpttgeaddegyedeyvledlevtiad
Timeline for d1pzda1: