SCOPe 2.08: Domain d1pzda1: 1pzd A:604-762

Lineage for d1pzda1 (1pzd A:604-762)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.3: Coatomer appendage domain [101536] (1 protein)

6. Protein Coatomer gamma subunit C-terminal domain, first subdomain [101537] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [101539] (1 PDB entry)

8. Domain d1pzda1: 1pzd A:604-762 [95413]
   Other proteins in same PDB: d1pzda2
   complexed with so4

Details for d1pzda1

PDB Entry: 1pzd, 2.31 Å

PDB Description: structural identification of a conserved appendage domain in the carboxyl-terminus of the copi gamma-subunit.

PDB Compounds: (A:) Coatomer gamma subunit

SCOPe Domain Sequences for d1pzda1:

Sequence; same for both SEQRES and ATOM records:

>d1pzda1 b.1.10.3 (A:604-762) Coatomer gamma subunit C-terminal domain, first subdomain {Cow (Bos taurus) [TaxId: 9913]}
kvaatrqeifqeqlaavpefqglgplfksspepvalteseteyvirctkhtftdhmvfqf
dctntlndqtlenvtvqmepseayevlcyvparslpynqpgtcytlvalpkedptavact
fscvmkftvkdcdpttgeaddegyedeyvledlevtiad

Timeline for d1pzda1:

• d1pzda1 first appeared in SCOP 1.67
  
• d1pzda1 appears in SCOPe 2.07