PDB entry 1pzd

View 1pzd on RCSB PDB site
Description: Structural Identification of a conserved appendage domain in the carboxyl-terminus of the COPI gamma-subunit.
Class: endocytosis/exocytosis
Keywords: platform domain, appendage domain, ear domain, ENDOCYTOSIS-EXOCYTOSIS COMPLEX
Deposited on 2003-07-10, released 2003-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.3099999999999996 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coatomer gamma subunit
    Species: Bos taurus [TaxId:9913]
    Gene: COPG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pzda1, d1pzda2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pzdA (A:)
    gsipgleralqqytlepsekpfdlksvplataplaeqrtestpvtaakqpekvaatrqei
    fqeqlaavpefqglgplfksspepvalteseteyvirctkhtftdhmvfqfdctntlndq
    tlenvtvqmepseayevlcyvparslpynqpgtcytlvalpkedptavactfscvmkftv
    kdcdpttgeaddegyedeyvledlevtiadhiqkvmklnfeaawdevgdefqkeetftls
    tiktleeavgnivkflgmhpcersdkvpdnknthtlllagvfrgghdilvrsrlllldtv
    tmqvtarsseelpvdivlasvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzdA (A:)
    kvaatrqeifqeqlaavpefqglgplfksspepvalteseteyvirctkhtftdhmvfqf
    dctntlndqtlenvtvqmepseayevlcyvparslpynqpgtcytlvalpkedptavact
    fscvmkftvkdcdpttgeaddegyedeyvledlevtiadhiqkvmklnfeaawdevgdef
    qkeetftlstiktleeavgnivkflgmhpcersdkvpdnknthtlllagvfrgghdilvr
    srlllldtvtmqvtarsseelpvdivlasvg