Lineage for d1pz3a1 (1pz3 A:5-17,A:385-501)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2420233Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 2420234Protein Alpha-l-arabinofuranosidase [101924] (2 species)
    glycosyl hydrolase family 51
  7. 2420235Species Bacillus stearothermophilus [TaxId:1422] [101925] (5 PDB entries)
  8. 2420242Domain d1pz3a1: 1pz3 A:5-17,A:385-501 [95396]
    Other proteins in same PDB: d1pz3a2, d1pz3b2
    complexed with gol

Details for d1pz3a1

PDB Entry: 1pz3 (more details), 1.75 Å

PDB Description: crystal structure of a family 51 (gh51) alpha-l-arabinofuranosidase from geobacillus stearothermophilus t6
PDB Compounds: (A:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d1pz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pz3a1 b.71.1.2 (A:5-17,A:385-501) Alpha-l-arabinofuranosidase {Bacillus stearothermophilus [TaxId: 1422]}
katmiiekdfkiaXgvalhpvisspkydskdftdvpylesiavyneekeevtifavnrdm
edalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrkvsatlp
klswnvirlgk

SCOPe Domain Coordinates for d1pz3a1:

Click to download the PDB-style file with coordinates for d1pz3a1.
(The format of our PDB-style files is described here.)

Timeline for d1pz3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pz3a2