SCOPe 2.06: Domain d1px5b1: 1px5 B:201-349

Lineage for d1px5b1 (1px5 B:201-349)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein)
   automatically mapped to Pfam PF10421

6. Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [101273] (2 PDB entries)

8. Domain d1px5b1: 1px5 B:201-349 [95279]
   Other proteins in same PDB: d1px5a2, d1px5b2
   complexed with so4

Details for d1px5b1

PDB Entry: 1px5, 1.74 Å

PDB Description: Crystal structure of the 2'-specific and double-stranded RNA-activated interferon-induced antiviral protein 2'-5'-oligoadenylate synthetase

PDB Compounds: (B:) 2'-5'-oligoadenylate synthetase 1

SCOPe Domain Sequences for d1px5b1:

Sequence; same for both SEQRES and ATOM records:

>d1px5b1 a.160.1.2 (B:201-349) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Pig (Sus scrofa) [TaxId: 9823]}
ptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktdfstaqgfqtvle
lvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnvgggdthswqrla
qearvwlgypccknldgslvgawtmlqki

Timeline for d1px5b1:

• d1px5b1 first appeared in SCOP 1.67
  
• d1px5b1 appears in SCOPe 2.05
  
• d1px5b1 appears in SCOPe 2.07
  
• d1px5b1 appears in the current release, SCOPe 2.08