SCOPe 2.04: Domain d1pwwb1: 1pww B:28-263

Lineage for d1pwwb1 (1pww B:28-263)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
   automatically mapped to Pfam PF07737

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1pwwb1: 1pww B:28-263 [95259]
   Other proteins in same PDB: d1pwwa3, d1pwwb3
   complexed with an optimized peptide substrate (chains C and D) in the presence of zinc
   complexed with zn; mutant

Details for d1pwwb1

PDB Entry: 1pww, 2.8 Å

PDB Description: crystal structure of anthrax lethal factor active site mutant protein complexed with an optimised peptide substrate in the presence of zinc.

PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1pwwb1:

Sequence; same for both SEQRES and ATOM records:

>d1pwwb1 d.92.1.14 (B:28-263) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
rnktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgd
itkhislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnv
yyeigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefle
qnsnevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

Timeline for d1pwwb1:

• d1pwwb1 first appeared in SCOP 1.67
  
• d1pwwb1 appears in SCOPe 2.03
  
• d1pwwb1 appears in SCOPe 2.05
  
• d1pwwb1 appears in the current release, SCOPe 2.08