Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) |
Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein) |
Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species) duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain |
Species Bacillus anthracis [TaxId:1392] [69777] (9 PDB entries) |
Domain d1pwub1: 1pwu B:33-263 [95247] Other proteins in same PDB: d1pwua3, d1pwub3 complexed with small molecule inhibitor |
PDB Entry: 1pwu (more details), 2.7 Å
SCOP Domain Sequences for d1pwub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pwub1 d.92.1.14 (B:33-263) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis [TaxId: 1392]} eehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgditkhi slealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnvyyeig kilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefleqnsne vqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr
Timeline for d1pwub1: