Lineage for d1pwub1 (1pwu B:33-263)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964794Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 2964795Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 2964796Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)
  8. 2964808Domain d1pwub1: 1pwu B:33-263 [95247]
    Other proteins in same PDB: d1pwua3, d1pwub3
    complexed with small molecule inhibitor
    complexed with gm6, zn

Details for d1pwub1

PDB Entry: 1pwu (more details), 2.7 Å

PDB Description: crystal structure of anthrax lethal factor complexed with (3-(n- hydroxycarboxamido)-2-isobutylpropanoyl-trp-methylamide), a known small molecule inhibitor of matrix metalloproteases.
PDB Compounds: (B:) Lethal Factor

SCOPe Domain Sequences for d1pwub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pwub1 d.92.1.14 (B:33-263) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
eehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgditkhi
slealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnvyyeig
kilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefleqnsne
vqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

SCOPe Domain Coordinates for d1pwub1:

Click to download the PDB-style file with coordinates for d1pwub1.
(The format of our PDB-style files is described here.)

Timeline for d1pwub1: