SCOP 1.69: Domain d1pwub1: 1pwu B:33-263

Lineage for d1pwub1 (1pwu B:33-263)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Bacillus anthracis [TaxId:1392] [69777] (7 PDB entries)

8. Domain d1pwub1: 1pwu B:33-263 [95247]
   Other proteins in same PDB: d1pwua3, d1pwub3

Details for d1pwub1

PDB Entry: 1pwu, 2.7 Å

PDB Description: crystal structure of anthrax lethal factor complexed with (3-(n- hydroxycarboxamido)-2-isobutylpropanoyl-trp-methylamide), a known small molecule inhibitor of matrix metalloproteases.

SCOP Domain Sequences for d1pwub1:

Sequence; same for both SEQRES and ATOM records:

>d1pwub1 d.92.1.14 (B:33-263) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis}
eehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdgditkhi
slealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekalnvyyeig
kilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefleqnsne
vqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

Timeline for d1pwub1:

• d1pwub1 first appeared in SCOP 1.67
  
• d1pwub1 appears in SCOP 1.71
  
• d1pwub1 appears in the current release, SCOPe 2.08