SCOPe 2.04: Domain d1pwua3: 1pwu A:264-550

Lineage for d1pwua3 (1pwu A:264-550)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Anthrax toxin lethal factor, middle domain [69845] (1 species)
   includes an all-alpha insert subdomain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69846] (9 PDB entries)

8. Domain d1pwua3: 1pwu A:264-550 [95246]
   Other proteins in same PDB: d1pwua1, d1pwua2, d1pwub1, d1pwub2
   complexed with small molecule inhibitor
   complexed with gm6, zn

Details for d1pwua3

PDB Entry: 1pwu, 2.7 Å

PDB Description: crystal structure of anthrax lethal factor complexed with (3-(n- hydroxycarboxamido)-2-isobutylpropanoyl-trp-methylamide), a known small molecule inhibitor of matrix metalloproteases.

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1pwua3:

Sequence; same for both SEQRES and ATOM records:

>d1pwua3 d.166.1.1 (A:264-550) Anthrax toxin lethal factor, middle domain {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mlsryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriq
idssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldi
qpydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmni
nnltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwri
qlspdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Timeline for d1pwua3:

• d1pwua3 first appeared in SCOP 1.67
  
• d1pwua3 appears in SCOPe 2.03
  
• d1pwua3 appears in SCOPe 2.05
  
• d1pwua3 appears in the current release, SCOPe 2.08