SCOP 1.67: Domain d1pwpb2: 1pwp B:551-776

Lineage for d1pwpb2 (1pwp B:551-776)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Bacillus anthracis [TaxId:1392] [69777] (7 PDB entries)

8. Domain d1pwpb2: 1pwp B:551-776 [95236]
   Other proteins in same PDB: d1pwpa3, d1pwpb3
   complexed with small molecule inhibitor
   complexed with nsc, zn

Details for d1pwpb2

PDB Entry: 1pwp, 2.9 Å

PDB Description: Crystal Structure of the Anthrax Lethal Factor complexed with Small Molecule Inhibitor NSC 12155

SCOP Domain Sequences for d1pwpb2:

Sequence; same for both SEQRES and ATOM records:

>d1pwpb2 d.92.1.14 (B:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

Timeline for d1pwpb2:

• d1pwpb2 is new in SCOP 1.67
  
• d1pwpb2 appears in SCOP 1.69
  
• d1pwpb2 appears in the current release, SCOPe 2.08